General Information

  • ID:  hor003245
  • Uniprot ID:  A0A8C2TPG4
  • Protein name:  Nociceptin
  • Gene name:  PNOC
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  YGGFIGVRKSARKWNNQ
  • Length:  17(144-160)
  • Propeptide:  MRAVLWDLLLLCLFARARSDCRGDCLRCDRHFYHDGFDLLVCILECEGEAVPRATWEMCATSIRSAPRPGATGVLGAMEPAEAVASPLQVSELLRRRDAEDGGAGMAPGAFPSQDEDISRRLGGGFPRETRGSWPAARGVQKRYGGFIGVRKSARKWNNQKRFSEFLKQYLGMSPRSTFRHRIPAPSARHRQN
  • Signal peptide:  MRAVLWDLLLLCLFARARS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003245_AF2.pdbhor003245_ESM.pdb

Physical Information

Mass: 226681 Formula: C89H137N29O23
Absent amino acids: CDEHLMPT Common amino acids: G
pI: 11.68 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: -107.06 Boman Index: -4440
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 45.88
Instability Index: 1450 Extinction Coefficient cystines: 6990
Absorbance 280nm: 436.88

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon